MetaQuery: quantitative analysis of the human gut microbiome

Results

Estimated gene abundances and results from statistical analyses

Job details:

Submission date: 2019-12-18 23:43:01 PST
Job id & description: 1567, EncP_Sm
Query type: protein
Count queries & homologs: 1, 389
Min % identity & max e-value: 30%, 1e-5
Min % query & target coverage: 70%, 70%

Click here to download results

Table of contents:


Gut microbiome genes homologous to your query gene:

query_id target_id status kegg eggnog phylum genus query_cov target_cov percent_identity
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV821127CompleteK01745COG2986ProteobacteriaKlebsiella97.7984.0651.92
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV908503CompleteK01745COG2986FirmicutesClostridium98.0183.9939.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV929838CompleteK01745COG2986unknownunknown95.3682.8338.34
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV938873CompleteK01745COG2986unknownunknown95.1482.9739.12
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV900796CompleteK01745COG2986unknownunknown98.0184.0239.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV894884CompleteK01745COG2986unknownunknown98.6884.0937.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV901123CompleteK01745COG2986unknownunknown93.1679.6840.52
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886046CompleteK01745COG2986Fusobacteriaunknown96.9185.9139.39
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV898443CompleteK01745COG2986unknownunknown97.3583.2740.14
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV902009CompleteK01745COG2986unknownunknown97.1385.438.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886539CompleteK01745COG2986unknownunknown95.8181.838.53
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV834807CompleteK01745COG2986FirmicutesClostridium93.3877.8239.76
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV901750CompleteK01745COG2986unknownunknown98.0184.0240.09
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV898181CompleteK01745COG2986unknownunknown92.7279.5339.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV838682Lack 5'-endK01745COG2986FusobacteriaFusobacterium97.1380.8438.6
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV890696CompleteK01745COG2986unknownunknown93.8280.039.2
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV866404CompleteK01745COG2986unknownunknown97.1381.7538.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV889002CompleteK01745COG2986unknownunknown95.8181.5738.85
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV893663CompleteK01745COG2986unknownunknown98.984.2837.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV859763CompleteK01745COG2986unknownunknown98.983.3738.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886127CompleteK01745COG2986FusobacteriaFusobacterium93.8280.0440.28
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV900800CompleteK01745COG2986unknownunknown98.0184.0240.54
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV904065CompleteK01745COG2986unknownunknown96.9185.2138.67
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV864714CompleteK01745COG2986FirmicutesStreptococcus98.4582.9538.84
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV864164CompleteK01745COG2986FirmicutesStreptococcus98.4582.9538.84
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV889808CompleteK01745COG2986unknownunknown98.6884.1238.17
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1330689Lack 5'-endK01745COG2986FusobacteriaFusobacterium93.8293.5939.34
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV860576CompleteK01745COG2986FusobacteriaFusobacterium96.4781.0437.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV864592CompleteK01745COG2986FirmicutesStreptococcus98.4582.9538.62
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV866941Lack 5'-endK01745COG2986unknownunknown95.1480.7838.71
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV856609CompleteK01745COG2986unknownunknown97.5781.8237.98
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV877835CompleteK01745COG2986FirmicutesStreptococcus98.4583.4338.62
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV827544CompleteK01745COG2986FusobacteriaFusobacterium93.1677.3337.88
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV863271CompleteK01745COG2986unknownunknown96.0382.5637.61
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV887039CompleteK01745COG2986FusobacteriaFusobacterium92.9479.0636.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV877891CompleteK01745COG2986FirmicutesStreptococcus98.4583.4337.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV885041CompleteK01745COG2986FusobacteriaFusobacterium94.780.8239.21
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV879720CompleteK01745COG2986unknownunknown96.4781.6438.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV860146CompleteK01745COG2986unknownunknown94.9279.538.98
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV877974CompleteK01745COG2986FirmicutesStreptococcus95.8181.2937.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV865870CompleteK01745COG2986unknownunknown97.7982.7237.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV894969Lack 3'-endK01745COG2986FirmicutesStreptococcus95.8181.7637.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV887588CompleteK01745COG2986Firmicutesunknown96.6982.7537.87
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV877971CompleteK01745COG2986FirmicutesStreptococcus95.8181.2937.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV875952CompleteK01745COG2986FirmicutesStreptococcus95.8181.2937.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV851543CompleteK01745COG2986FirmicutesAcidaminococcus98.6883.0436.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV889952CompleteK01745COG2986FirmicutesClostridium96.6982.7538.1
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV819981CompleteK01745COG2986FirmicutesAcidaminococcus94.9279.8938.32
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1689962Lack both endsK01745COG2986Fusobacteriaunknown87.295.4538.89
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1450841CompleteK01745COG2986unknownunknown92.4995.538.15
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV847183CompleteK01745COG2986FirmicutesAcidaminococcus95.1481.1538.24
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV844434CompleteK01745COG2986FirmicutesAcidaminococcus95.1481.1538.24
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV888336CompleteK01745COG2986unknownunknown96.6982.7537.19
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV850025CompleteK01745COG2986FirmicutesAcidaminococcus98.0182.4737.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV888991CompleteK01745COG2986FirmicutesClostridium96.0382.1637.21
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV887799CompleteK01745COG2986Firmicutesunknown99.1284.937.61
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV811826CompleteK01745COG2986FirmicutesAcidaminococcus98.0180.9137.5
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV877959CompleteK01745COG2986FirmicutesPeptoniphilus96.4782.4638.37
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV858708CompleteK01745COG2986unknownunknown98.4583.5636.5
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV826101CompleteK01745COG2986unknownunknown96.0380.5736.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886375CompleteK01745COG2986Firmicutesunknown96.6982.5837.19
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV859505CompleteK01745COG2986Firmicutesunknown96.6981.6237.19
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV859019CompleteK01745COG2986unknownunknown98.4583.5636.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV883792CompleteK01745COG2986FirmicutesBlautia96.0382.036.76
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV891820CompleteK01745COG2986unknownunknown98.6886.8436.16
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV881249CompleteK01745COG2986FirmicutesPeptoniphilus94.9281.0536.55
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV887999CompleteK01745COG2986unknownunknown97.7986.0836.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV864084CompleteK01745COG2986unknownunknown96.0382.5636.71
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV876221Lack 5'-endK01745COG2986FirmicutesPeptoniphilus94.9280.936.32
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV882656CompleteK01745COG2986unknownunknown98.0186.1136.4
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV885652CompleteK01745COG2986FirmicutesBlautia96.0382.036.99
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV827360CompleteK01745COG2986unknownunknown96.0380.5736.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV784941CompleteK01745COG2986FirmicutesBlautia96.0378.0336.99
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV964944CompleteK01745COG2986unknownunknown95.1483.035.5
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV874886CompleteK01745COG2986unknownunknown96.0382.4637.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV884183CompleteK01745COG2986FirmicutesBlautia96.0382.036.99
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV964170CompleteK01745COG2986unknownunknown94.9282.7935.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV876582CompleteK01745COG2986unknownunknown95.1481.6836.61
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV972762CompleteK01745COG2986BacteroidetesAlistipes94.9282.9636.98
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV936025CompleteK01745COG2986BacteroidetesAlistipes94.9281.837.21
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV918539CompleteK01745COG2986BacteroidetesAlistipes95.5884.9237.47
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV972619CompleteK01745COG2986Bacteroidetesunknown94.9282.9636.51
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV963060CompleteK01745COG2986unknownunknown94.9282.7935.58
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV876704CompleteK01745COG2986unknownunknown95.1481.6836.61
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV885475CompleteK01745COG2986Firmicutesunknown96.6982.5836.51
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV953460CompleteK01745COG2986BacteroidetesAlistipes94.782.2636.6
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV876717CompleteK01745COG2986unknownunknown95.1481.6836.61
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV958762CompleteK01745COG2986unknownunknown95.5883.2335.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV899394Lack 5'-endK01745COG2986BacteroidetesAlistipes92.9482.4837.44
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886798CompleteK01745COG2986unknownunknown93.1682.1936.79
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV799961CompleteK01745COG2986unknownunknown98.6883.2735.71
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV933169CompleteK01745COG2986BacteroidetesAlistipes94.9281.6436.51
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV840328CompleteK01745COG2986unknownunknown95.8181.5737.7
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV922774CompleteK01745COG2986unknownunknown96.4786.0835.84
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV837897CompleteK01745COG2986unknownunknown96.9181.834.6
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV971484CompleteK01745COG2986BacteroidetesAlistipes94.782.7637.06
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV971191CompleteK01745COG2986BacteroidetesAlistipes94.782.7636.36
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV967794CompleteK01745COG2986BacteroidetesAlistipes94.9282.9635.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV877475CompleteK01745COG2986unknownunknown95.1481.6836.16
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV909797CompleteK01745COG2986ProteobacteriaCitrobacter96.9183.236.71
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV850103CompleteK01745COG2986ActinobacteriaBifidobacterium99.5684.5936.7
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV841308CompleteK01745COG2986unknownunknown94.2679.6536.53
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV576596CompleteK01745COG2986unknownunknown98.2371.6935.24
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV942790CompleteK01745COG2986unknownunknown98.2384.7735.06
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV892223CompleteK01745COG2986Bacteroidetesunknown93.3882.5135.85
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1515370CompleteK01745COG2986unknownunknown89.6295.1736.65
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV967885CompleteK01745COG2986BacteroidetesAlistipes94.782.7636.6
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV979614CompleteK01745COG2986unknownunknown95.5883.9134.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV851597CompleteK01745COG2986unknownunknown94.9279.3835.42
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV748956Lack 5'-endK01745COG2986Firmicutesunknown98.2379.1635.02
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV970145CompleteK01745COG2986Bacteroidetesunknown94.9282.9635.35
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943530CompleteK01745COG2986unknownunknown94.9282.1334.42
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV962203CompleteK01745COG2986Bacteroidetesunknown94.9282.6336.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944306CompleteK01745COG2986unknownunknown95.5882.7335.1
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV909869CompleteK01745COG2986ProteobacteriaCitrobacter91.6177.8737.5
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV908862CompleteK01745COG2986ProteobacteriaEnterobacter94.9281.6236.19
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV875360CompleteK01745COG2986unknownunknown98.6884.837.31
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV840863CompleteK01745COG2986unknownunknown99.1283.8835.29
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV969391CompleteK01745COG2986unknownunknown94.9282.9634.19
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV970407CompleteK01745COG2986unknownunknown94.4882.5635.51
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV962150CompleteK01745COG2986unknownunknown95.1482.8334.34
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV909125CompleteK01745COG2986ProteobacteriaEnterobacter94.9281.6236.43
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1344752Lack 3'-endK01745COG2986unknownunknown84.7783.9438.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV960363CompleteK01745COG2986unknownunknown97.1384.4434.09
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV842018CompleteK01745COG2986Firmicutesunknown97.5782.5334.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV967856CompleteK01745COG2986BacteroidetesAlistipes94.9282.9635.58
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV960323CompleteK01745COG2986unknownunknown97.1384.4434.09
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV909949CompleteK01745COG2986ProteobacteriaEnterobacter92.9479.8436.97
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV909173CompleteK01745COG2986ProteobacteriaEnterobacter94.9281.6236.28
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV968742CompleteK01745COG2986unknownunknown95.1483.1633.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV876590CompleteK01745COG2986unknownunknown98.2384.4136.36
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV836346CompleteK01745COG2986Firmicutesunknown98.2382.9535.46
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV959748CompleteK01745COG2986unknownunknown95.3683.0333.56
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886907Lack 5'-endK01745COG2986BacteroidetesBacteroides94.9284.9334.25
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV974116CompleteK01745COG2986unknownunknown94.782.9334.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV891811CompleteK01745COG2986BacteroidetesBacteroides96.2586.4434.98
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV884104CompleteK01745COG2986Firmicutesunknown96.0382.035.62
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV837298CompleteK01745COG2986unknownunknown97.5782.3834.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV894159CompleteK01745COG2986Bacteroidetesunknown96.0384.8734.63
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV975230CompleteK01745COG2986unknownunknown94.782.9334.27
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV948389CompleteK01745COG2986Bacteroidetesunknown94.9282.2934.87
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV857468CompleteK01745COG2986unknownunknown96.4783.7534.7
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV902953CompleteK01745COG2986unknownunknown95.1480.8734.11
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV824679CompleteK01745COG2986ProteobacteriaEnterobacter97.3580.6136.36
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV960119CompleteK01745COG2986unknownunknown98.2385.4533.71
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV957381CompleteK01745COG2986unknownunknown95.1482.6633.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV966608CompleteK01745COG2986unknownunknown95.1483.034.11
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV877191CompleteK01745COG2986Bacteroidetesunknown93.1681.6835.93
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV953561CompleteK01745COG2986unknownunknown95.3682.8634.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV964734CompleteK01745COG2986unknownunknown95.1483.034.11
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV911948CompleteK01745COG2986unknownunknown94.780.7934.27
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV894644Lack 5'-endK01745COG2986BacteroidetesBacteroides95.1485.4633.94
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV827526CompleteK01745COG2986unknownunknown95.1480.3835.21
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV715683CompleteK01745COG2986unknownunknown96.0375.9436.05
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV977279CompleteK01745COG2986unknownunknown94.782.9334.27
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV909138CompleteK01745COG2986ProteobacteriaEnterobacter94.9281.6236.32
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV958643CompleteK01745COG2986unknownunknown97.1384.4433.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV895347CompleteK01745COG2986BacteroidetesBacteroides96.0384.8734.4
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV959646CompleteK01745COG2986unknownunknown95.5883.2335.33
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV972234CompleteK01745COG2986Bacteroidetesunknown94.9282.9635.35
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV838471CompleteK01745COG2986unknownunknown93.678.9334.87
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV842050CompleteK01745COG2986unknownunknown99.1283.8833.99
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV912071Lack 5'-endK01745COG2986unknownunknown94.780.7934.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV949078CompleteK01745COG2986unknownunknown95.1482.4933.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV877897CompleteK01745COG2986BacteroidetesBacteroides93.1681.6835.22
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943308CompleteK01745COG2986unknownunknown94.9282.1333.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV976977CompleteK01745COG2986unknownunknown94.782.9334.27
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV837929CompleteK01745COG2986Firmicutesunknown98.2382.9534.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV965262CompleteK01745COG2986unknownunknown94.782.5934.27
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV978188CompleteK01745COG2986unknownunknown95.5883.9133.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV850346CompleteK01745COG2986unknownunknown95.5879.3834.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV967893CompleteK01745COG2986unknownunknown95.8184.3833.87
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV980050CompleteK01745COG2986unknownunknown94.783.134.27
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV949428CompleteK01745COG2986unknownunknown94.9282.2933.26
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV902125CompleteK01745COG2986Bacteroidetesunknown96.2585.433.87
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV903646Lack 5'-endK01745COG2986unknownunknown94.780.4733.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV861678CompleteK01745COG2986unknownunknown96.9185.6634.44
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV885864CompleteK01745COG2986ProteobacteriaProvidencia95.1481.0235.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV983187CompleteK01745COG2986BacteroidetesPrevotella94.783.133.57
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV975712CompleteK01745COG2986unknownunknown94.782.9333.57
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV979033CompleteK01745COG2986unknownunknown94.783.134.27
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV922943CompleteK01745COG2986unknownunknown96.4786.0834.7
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV973279CompleteK01745COG2986unknownunknown94.782.9333.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV949841CompleteK01745COG2986unknownunknown95.1482.4933.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV921163Lack 3'-endK01745COG2986unknownunknown93.8281.9435.84
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV869355CompleteK01745COG2986unknownunknown93.681.9135.92
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV974682CompleteK01745COG2986unknownunknown94.782.9334.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV983199CompleteK01745COG2986BacteroidetesPrevotella95.8184.1133.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV906211CompleteK01745COG2986unknownunknown96.6982.2133.33
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV949029CompleteK01745COG2986unknownunknown95.8183.132.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV871848Lack 5'-endK01745COG2986BacteroidetesAlistipes92.9481.5236.02
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1782797Lack both endsK01745COG2986FirmicutesBlautia85.4396.1136.67
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV963149CompleteK01745COG2986BacteroidetesAlistipes95.5883.434.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV948455CompleteK01745COG2986unknownunknown95.1482.4933.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV903250CompleteK01745COG2986Bacteroidetesunknown96.0385.2134.1
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV882676CompleteK01745COG2986unknownunknown92.9482.3935.85
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV948755CompleteK01745COG2986unknownunknown94.4881.8932.94
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV863551CompleteK01745COG2986Proteobacteriaunknown95.3680.2335.42
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1331242Lack 5'-endK01745COG2986Bacteroidetesunknown94.9293.5933.02
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV953654CompleteK01745COG2986unknownunknown98.6885.6932.66
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV916615CompleteK01745COG2986unknownunknown95.8182.1434.25
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV893269CompleteK01745COG2986Bacteroidetesunknown96.2586.4433.78
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV933900CompleteK01745COG2986unknownunknown98.4584.832.96
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV869842CompleteK01745COG2986unknownunknown95.5884.2436.26
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV948229CompleteK01745COG2986unknownunknown95.1482.4933.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV837057CompleteK01745COG2986unknownunknown94.4877.9734.11
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV905189CompleteK01745COG2986ProteobacteriaKlebsiella94.779.6835.81
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV836263CompleteK01745COG2986BacteroidetesBacteroides96.9183.3734.32
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV907194CompleteK01745COG2986unknownunknown97.5783.032.13
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV902069CompleteK01745COG2986ProteobacteriaKlebsiella94.779.6836.05
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV914229CompleteK01745COG2986unknownunknown97.5783.1731.9
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886115CompleteK01745COG2986ProteobacteriaEnterobacter96.4782.1935.75
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV916267CompleteK01745COG2986unknownunknown96.0382.1431.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV933071CompleteK01745COG2986unknownunknown95.8182.4432.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV882910CompleteK01745COG2986unknownunknown95.5883.7635.01
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV905134CompleteK01745COG2986unknownunknown96.2585.433.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944579CompleteK01745COG2986unknownunknown95.1482.3333.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944167CompleteK01745COG2986unknownunknown95.5884.1432.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV898859CompleteK01745COG2986ProteobacteriaKlebsiella96.4782.8735.75
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV927537CompleteK01745COG2986unknownunknown95.5882.0731.87
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV965495CompleteK01745COG2986unknownunknown94.4882.3931.78
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV933091CompleteK01745COG2986unknownunknown95.8182.4432.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV933090CompleteK01745COG2986unknownunknown95.5882.2432.56
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV948173CompleteK01745COG2986unknownunknown95.1482.4933.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV983161CompleteK01745COG2986BacteroidetesPrevotella95.8184.1132.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV915957CompleteK01745COG2986unknownunknown95.1481.3531.79
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV945904CompleteK01745COG2986unknownunknown93.8281.7333.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV887058CompleteK01745COG2986Proteobacteriaunknown96.9182.5836.22
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV909508CompleteK01745COG2986unknownunknown92.9482.8134.51
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1845579Lack 5'-endK01745COG2986Firmicutesunknown82.7894.7236.51
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943552CompleteK01745COG2986unknownunknown93.8281.7333.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943595CompleteK01745COG2986unknownunknown97.1384.5432.96
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV899736CompleteK01745COG2986ProteobacteriaKlebsiella96.4782.8735.29
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV924887CompleteK01745COG2986unknownunknown95.3681.8732.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886186CompleteK01745COG2986ProteobacteriaKlebsiella96.4782.3935.07
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV684966CompleteK01745COG2986BacteroidetesBacteroides96.9176.934.54
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1550447Lack 5'-endK01745COG2986unknownunknown86.5394.8837.82
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1549709Lack both endsK01745COG2986unknownunknown86.5390.7535.46
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947634CompleteK01745COG2986unknownunknown93.8281.7333.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV830837CompleteK01745COG2986unknownunknown96.0382.6333.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2463075Lack both endsK01745COG2986unknownunknown76.1699.6937.1
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943471CompleteK01745COG2986unknownunknown95.1482.3332.71
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV948356CompleteK01745COG2986unknownunknown95.1482.4932.48
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV904632CompleteK01745COG2986BacteroidetesBacteroides95.3684.6233.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV904822CompleteK01745COG2986unknownunknown96.0381.6632.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV907193CompleteK01745COG2986unknownunknown92.9482.8134.27
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV953250CompleteK01745COG2986unknownunknown95.1482.6632.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV848831CompleteK01745COG2986unknownunknown93.3881.534.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2000505Lack both endsK01745COG2986Firmicutesunknown82.3497.5336.6
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV941681CompleteK01745COG2986BacteroidetesPorphyromonas97.1383.7733.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV884152CompleteK01745COG2986unknownunknown94.4883.3733.57
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV925536CompleteK01745COG2986unknownunknown94.9281.4732.56
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV925471CompleteK01745COG2986unknownunknown94.9281.4732.79
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV872963CompleteK01745COG2986unknownunknown95.1484.8234.17
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947722CompleteK01745COG2986unknownunknown97.1384.1431.59
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV890229CompleteK01745COG2986unknownunknown96.6981.7632.57
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV940949CompleteK01745COG2986BacteroidetesPorphyromonas98.4584.9732.74
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV868707CompleteK01745COG2986unknownunknown97.1381.3631.59
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1679023Lack 5'-endK01745COG2986unknownunknown88.397.9834.24
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1050916Lack 5'-endK01745COG2986BacteroidetesPorphyromonas98.4588.732.96
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944313CompleteK01745COG2986Bacteroidetesunknown96.0383.1332.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1091298Lack 5'-endK01745COG2986unknownunknown97.1388.9631.36
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944525CompleteK01745COG2986unknownunknown97.1384.1431.36
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV913792CompleteK01745COG2986unknownunknown94.9280.9931.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1576365Lack 3'-endK01745COG2986FirmicutesStreptococcus77.9281.6237.92
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV938953CompleteK01745COG2986unknownunknown95.1482.1631.55
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944416CompleteK01745COG2986Bacteroidetesunknown96.0383.1332.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV863928CompleteK01745COG2986BacteroidetesPrevotella92.9481.0133.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947970CompleteK01745COG2986BacteroidetesBacteroides96.0383.1332.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943385CompleteK01745COG2986Bacteroidetesunknown97.1384.3431.14
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV946346CompleteK01745COG2986unknownunknown97.1384.1431.14
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV945226CompleteK01745COG2986Bacteroidetesunknown96.0383.1332.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV865634CompleteK01745COG2986unknownunknown97.5786.0233.26
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV941463CompleteK01745COG2986BacteroidetesBacteroides96.0382.9732.87
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV935372CompleteK01745COG2986Bacteroidetesunknown96.0382.831.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV867902CompleteK01745COG2986unknownunknown97.5786.0234.15
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV945369CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV938983CompleteK01745COG2986Bacteroidetesunknown96.0382.9732.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943388CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943228CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV876262CompleteK01745COG2986FirmicutesBlautia98.2383.0433.04
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947205CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2055886Lack 5'-endK01745COG2986unknownunknown78.59100.037.53
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV945903CompleteK01745COG2986Bacteroidetesunknown96.0383.1332.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944150CompleteK01745COG2986unknownunknown95.1482.3331.79
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV938789CompleteK01745COG2986BacteroidetesBacteroides96.0382.9732.64
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943447CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV812495CompleteK01745COG2986unknownunknown97.1379.430.91
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947213CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947088CompleteK01745COG2986Bacteroidetesunknown96.0383.1331.05
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944484CompleteK01745COG2986Bacteroidetesunknown96.0383.1331.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV936313Lack 5'-endK01745COG2986BacteroidetesBacteroides96.0382.831.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947488CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886854Lack 5'-endK01745COG2986BacteroidetesBacteroides96.0381.0231.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV962198CompleteK01745COG2986unknownunknown94.4882.2232.48
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV900798Lack 5'-endK01745COG2986BacteroidetesBacteroides96.0381.6632.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947347CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV942444CompleteK01745COG2986Bacteroidetesunknown96.0382.9731.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV939825CompleteK01745COG2986BacteroidetesBacteroides96.0382.9731.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV934801CompleteK01745COG2986Bacteroidetesunknown96.0382.831.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV895968CompleteK01745COG2986BacteroidetesOdoribacter93.8279.5731.29
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1030327CompleteK01745COG2986unknownunknown95.3687.9732.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943217CompleteK01745COG2986BacteroidetesBacteroides96.0383.1330.82
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV942727CompleteK01745COG2986unknownunknown96.0382.9731.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV945446CompleteK01745COG2986unknownunknown96.0383.1331.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944021CompleteK01745COG2986Bacteroidetesunknown96.0383.1331.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV923512Lack 5'-endK01745COG2986BacteroidetesBacteroides96.0382.3130.59
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943331CompleteK01745COG2986Bacteroidetesunknown96.0383.1331.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947435CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943351CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943571CompleteK01745COG2986BacteroidetesBacteroides96.0383.1332.12
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV941925CompleteK01745COG2986unknownunknown96.0382.9731.26
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV945674CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV945218CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944195CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV946991CompleteK01745COG2986Bacteroidetesunknown96.0383.1331.28
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV947441CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.95
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV938934CompleteK01745COG2986BacteroidetesBacteroides96.0382.9732.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV931626Lack 5'-endK01745COG2986BacteroidetesBacteroides96.0382.6332.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944455CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944950CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.26
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV944842CompleteK01745COG2986Bacteroidetesunknown96.0383.1331.72
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2060178Lack 5'-endK01745COG2986BacteroidetesAlistipes81.2496.9336.41
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943736CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.89
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1884876Lack 5'-endK01745COG2986unknownunknown78.8192.036.09
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943743CompleteK01745COG2986BacteroidetesBacteroides96.0383.1331.26
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1027661CompleteK01745COG2986unknownunknown99.3491.4932.53
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV954326CompleteK01745COG2986Bacteroidetesunknown96.0383.4731.49
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2259425Lack 5'-endK01745COG2986unknownunknown74.8394.1336.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV893383CompleteK01745COG2986FirmicutesAcidaminococcus95.3681.1434.4
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV940275CompleteK01745COG2986unknownunknown96.0382.9730.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV895027CompleteK01745COG2986unknownunknown98.4583.8931.78
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV860084CompleteK01745COG2986unknownunknown95.3679.8834.62
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943365CompleteK01745COG2986BacteroidetesBacteroides94.781.5331.47
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1926455Lack both endsK01745COG2986BacteroidetesPrevotella82.3494.6233.78
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV785741CompleteK01745COG2986unknownunknown90.2977.832.62
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV758351CompleteK01745COG2986unknownunknown98.0178.4931.18
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2728100Lack both endsK01745COG2986FirmicutesStreptococcus72.19100.036.97
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV953271CompleteK01745COG2986BacteroidetesParabacteroides96.0383.4730.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV957181CompleteK01745COG2986BacteroidetesParabacteroides96.0383.4730.8
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV943819CompleteK01745COG2986Bacteroidetesunknown96.0383.1331.74
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV953463CompleteK01745COG2986BacteroidetesParabacteroides96.0383.4731.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV787021CompleteK01745COG2986unknownunknown90.2977.832.3
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV895046CompleteK01745COG2986unknownunknown96.9182.5131.67
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV785761CompleteK01745COG2986unknownunknown90.2977.832.15
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV827033Lack 5'-endK01745COG2986Bacteroidetesunknown96.0378.8631.28
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV892867CompleteK01745COG2986FirmicutesAcidaminococcus96.9182.5132.74
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV847447CompleteK01745COG2986unknownunknown93.678.0831.15
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV903729CompleteK01745COG2986unknownunknown98.984.4231.33
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1364471Lack 3'-endK01745COG2986Bacteroidetesunknown83.2282.2234.21
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV847449CompleteK01745COG2986unknownunknown97.7981.5431.61
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV900153CompleteK01745COG2986FirmicutesAcidaminococcus98.2383.8631.51
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV899518CompleteK01745COG2986unknownunknown96.2582.0932.12
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1650363Lack 5'-endK01745COG2986Bacteroidetesunknown91.1798.2531.01
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV896645CompleteK01745COG2986FirmicutesAcidaminococcus98.2383.8631.07
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV890171CompleteK01745COG2986unknownunknown98.2383.5332.52
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV890880CompleteK01745COG2986ProteobacteriaKlebsiella96.6981.9632.73
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1314598Lack both endsK01745COG2986BacteroidetesPorphyromonas85.6583.6432.65
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV886624CompleteK01745COG2986unknownunknown95.3680.8231.96
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV896830CompleteK01745COG2986unknownunknown96.2582.0931.44
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2695710Lack both endsK01745COG2986Firmicutesunknown71.96100.036.36
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV845408CompleteK01745COG2986unknownunknown97.5783.0831.13
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2066315Lack both endsK01745COG2986Bacteroidetesunknown83.4499.4432.54
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV845824CompleteK01745COG2986unknownunknown94.2678.6530.23
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV834962CompleteK01745COG2986unknownunknown95.8179.3533.03
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV845365CompleteK01745COG2986unknownunknown93.678.0831.15
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1220029Lack 3'-endK01745COG2986unknownunknown85.6581.6831.2
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV847672CompleteK01745COG2986unknownunknown95.5882.8830.31
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1292086Lack 3'-endK01745COG2986unknownunknown85.2182.6233.76
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV942616CompleteK01745COG2986ProteobacteriaKlebsiella94.781.9631.55
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV818835CompleteK01745COG2986unknownunknown98.981.5931.19
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV784394CompleteK01745COG2986unknownunknown91.3978.5831.53
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1685878Lack 3'-endK01745COG2986Firmicutesunknown73.2979.5535.42
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV941104CompleteK01745COG2986ProteobacteriaKlebsiella94.781.9631.09
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV858996CompleteK01745COG2986FirmicutesClostridium95.3679.8831.51
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV938892CompleteK01745COG2986unknownunknown95.8183.1730.05
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1827325Lack 3'-endK01745COG2986unknownunknown71.7479.5833.23
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV811627CompleteK01745COG2986unknownunknown95.5878.8330.37
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2223516Lack both endsK01745COG2986BacteroidetesBacteroides74.8392.1733.33
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV911728CompleteK01745COG2986unknownunknown90.9578.2231.08
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2252758Lack 5'-endK01745COG2986unknownunknown78.5998.2430.9
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1885665Lack 3'-endK01745COG2986BacteroidetesBacteroides70.6479.5233.12
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1631955Lack 3'-endK01745COG2986unknownunknown75.7284.5830.9
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2509564Lack 3'-endK01745COG2986unknownunknown72.1999.3833.33
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1835369Lack 3'-endK01745COG2986unknownunknown72.6381.134.44
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2785822Lack 5'-endK01745COG2986unknownunknown71.399.6730.96
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2189164Lack 5'-endK01745COG2986Bacteroidetesunknown79.9198.2730.94
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV1779768CompleteK01745COG2986unknownunknown75.590.3931.53
query_IDMTFVIELDMNVTLDQLEDAARQRTPVELSAPVRSRVRASRDVLVKFVQDERVIYGVNTSMGGFVDHLVPV2437014Lack 5'-endK01745COG2986FirmicutesBlautia71.0893.5830.77
Click on arrows to sort table data. Shift+click to sort by multiple columns.

The abundance of your query across gut microbiome samples:




The prevalence of your query across gut microbiome samples:




Taxonomic groups correlated with your query gene:

tax_level tax_name spearman_rho pvalue qvalue
familyBacteroidaceae0.8050.00.0
genusBacteroides0.8050.00.0
phylumBacteroidetes0.6213.56e-2003.36e-198
classBacteroidia0.6213.56e-2003.36e-198
orderBacteroidales0.6213.56e-2003.36e-198
phylumFirmicutes-0.5785.63e-1674.43e-165
genusParabacteroides0.5351.02e-1386.88e-137
classClostridia-0.5091e-1235.24e-122
orderClostridiales-0.5091e-1235.24e-122
genusDorea-0.5062.15e-1221.01e-120
speciesBacteroides_ovatus0.4863.48e-1111.49e-109
speciesRuminococcus_obeum-0.4791.27e-1075e-106
speciesDorea_longicatena-0.4762.56e-1069.29e-105
familyPorphyromonadaceae0.4714.46e-1041.5e-102
genusCoprococcus-0.4718.28e-1042.61e-102
speciesBacteroides_thetaiotaomicron0.4621.71e-995.04e-98
speciesCoprococcus_catus-0.4552.19e-966.08e-95
speciesDorea_formicigenerans-0.4326.32e-861.66e-84
familyRuminococcaceae-0.4241.34e-823.33e-81
speciesCoprococcus_comes-0.4234.03e-829.51e-81
speciesEubacterium_hallii-0.4158.37e-791.88e-77
speciesCollinsella_aerofaciens-0.4121.54e-773.3e-76
orderCoriobacteriales-0.4113.06e-776.02e-76
familyCoriobacteriaceae-0.4113.06e-776.02e-76
familyLachnospiraceae-0.411.48e-762.79e-75
speciesBacteroides_vulgatus0.3942.28e-704.14e-69
phylumActinobacteria-0.3913.57e-696.02e-68
classActinobacteria-0.3913.57e-696.02e-68
genusCollinsella-0.3875.58e-689.08e-67
speciesBacteroides_uniformis0.3691.66e-612.61e-60
genusFlavonifractor0.3685.44e-618.02e-60
speciesFlavonifractor_plautii0.3685.44e-618.02e-60
speciesBacteroides_fragilis0.3563.93e-575.62e-56
speciesClostridium_bolteae0.356.22e-558.63e-54
orderLactobacillales-0.3498.84e-551.19e-53
classBacilli-0.3475.25e-546.88e-53
speciesBifidobacterium_adolescentis-0.3461.01e-531.29e-52
speciesClostridiales_bacterium_1_7_47FAA0.3445.49e-536.82e-52
speciesEubacterium_ramulus-0.3421.83e-522.21e-51
genusRuminococcus-0.3383.49e-514.12e-50
speciesAnaerostipes_hadrus-0.3283.36e-483.87e-47
orderBifidobacteriales-0.3284.54e-484.98e-47
familyBifidobacteriaceae-0.3284.54e-484.98e-47
speciesRuminococcus_sp_5_1_39BFAA-0.3261.16e-471.24e-46
genusBifidobacterium-0.3261.21e-471.27e-46
speciesBacteroides_xylanisolvens0.3253.58e-473.67e-46
familyEubacteriaceae-0.326.24e-466.27e-45
genusEubacterium-0.328.01e-467.88e-45
familyStreptococcaceae-0.3183.93e-453.79e-44
speciesEubacterium_biforme-0.3177.61e-457.18e-44
genusStreptococcus-0.3099.96e-439.22e-42
familyClostridiales_noname0.3021.32e-401.2e-39
speciesClostridium_symbiosum0.2971.67e-391.49e-38
speciesClostridium_citroniae0.2941.26e-381.1e-37
speciesStreptococcus_salivarius-0.2919.84e-388.44e-37
speciesMethanobrevibacter_smithii-0.2911.09e-379.19e-37
classErysipelotrichia-0.2892.53e-372.02e-36
orderErysipelotrichales-0.2892.53e-372.02e-36
familyErysipelotrichaceae-0.2892.53e-372.02e-36
genusErysipelotrichaceae_noname-0.2884.12e-373.24e-36
classMethanobacteria-0.2862.01e-361.51e-35
orderMethanobacteriales-0.2862.01e-361.51e-35
familyMethanobacteriaceae-0.2862.01e-361.51e-35
familyActinomycetaceae-0.2852.1e-361.55e-35
genusActinomyces-0.2843.92e-362.85e-35
genusMethanobrevibacter-0.2812.16e-351.54e-34
genusOlsenella-0.285.47e-353.85e-34
speciesClostridium_hathewayi0.286.65e-354.62e-34
speciesSubdoligranulum_unclassified-0.2781.61e-341.1e-33
speciesOlsenella_unclassified-0.2781.66e-341.12e-33
phylumEuryarchaeota-0.2773.06e-342.03e-33
familyRikenellaceae0.2758.77e-345.67e-33
genusAlistipes0.2758.77e-345.67e-33
genusSubdoligranulum-0.2725.48e-333.5e-32
familyPrevotellaceae-0.271.59e-321e-31
genusAdlercreutzia-0.2692.24e-321.37e-31
speciesAdlercreutzia_equolifaciens-0.2692.24e-321.37e-31
orderActinomycetales-0.2692.45e-321.48e-31
familyOscillospiraceae0.2651.72e-311.01e-30
genusOscillibacter0.2651.72e-311.01e-30
speciesStreptococcus_parasanguinis-0.2643.18e-311.85e-30
familyPeptostreptococcaceae-0.2643.95e-312.27e-30
genusClostridiales_noname0.2634.81e-312.74e-30
genusPeptostreptococcaceae_noname-0.2635.09e-312.86e-30
speciesRuminococcus_gnavus0.2581e-295.55e-29
speciesEubacterium_rectale-0.2548.04e-294.41e-28
speciesLachnospiraceae_bacterium_5_1_63FAA-0.2531.2e-286.51e-28
speciesStreptococcus_thermophilus-0.2522.06e-281.1e-27
speciesClostridium_asparagiforme0.2497.11e-283.77e-27
genusAnaerostipes-0.2481.15e-276.03e-27
familyLactobacillaceae-0.2463.38e-271.75e-26
speciesBifidobacterium_longum-0.2464.03e-272.07e-26
speciesPrevotella_copri-0.2448.2e-274.16e-26
genusLactobacillus-0.2431.42e-267.13e-26
speciesOscillibacter_unclassified0.2431.55e-267.7e-26
speciesEubacterium_siraeum-0.2422.54e-261.25e-25
speciesStreptococcus_sanguinis-0.2364.11e-252e-24
speciesBilophila_unclassified0.2364.82e-252.32e-24
genusBilophila0.2358.51e-254.06e-24
speciesClostridium_clostridioforme0.2341.07e-245.05e-24
speciesParabacteroides_unclassified0.2315e-242.34e-23
speciesBacteroides_stercoris0.2214.66e-222.16e-21
genusButyrivibrio-0.2199.07e-224.16e-21
genusParaprevotella-0.2181.52e-216.9e-21
speciesParaprevotella_unclassified-0.2172.04e-219.17e-21
speciesCoprococcus_sp_ART55_1-0.2147.75e-213.42e-20
speciesFusobacterium_ulcerans0.2147.76e-213.42e-20
classDeltaproteobacteria0.2121.82e-207.81e-20
orderDesulfovibrionales0.2121.82e-207.81e-20
familyDesulfovibrionaceae0.2121.82e-207.81e-20
genusCatenibacterium-0.2113.37e-201.42e-19
speciesCatenibacterium_mitsuokai-0.2113.37e-201.42e-19
speciesRuminococcus_bromii-0.2071.61e-196.72e-19
speciesParabacteroides_distasonis0.2062.65e-191.1e-18
speciesPeptostreptococcaceae_noname_unclassified-0.2044.92e-192.02e-18
genusPrevotella-0.2044.96e-192.02e-18
phylumFusobacteria0.2045.96e-192.36e-18
classFusobacteriia0.2045.96e-192.36e-18
orderFusobacteriales0.2045.96e-192.36e-18
orderBacillales-0.2037.5e-192.95e-18
familyFusobacteriaceae0.2011.67e-186.51e-18
familyBacillales_noname-0.2011.83e-187.02e-18
genusGemella-0.2011.83e-187.02e-18
speciesRuminococcus_torques-0.1986.35e-182.42e-17
speciesParaprevotella_clara-0.1976.89e-182.6e-17
speciesBacteroides_nordii0.1979.17e-183.44e-17
genusFusobacterium0.1951.6e-175.94e-17
genusBlautia-0.1951.61e-175.94e-17
speciesBilophila_wadsworthia0.1951.92e-177.03e-17
genusSolobacterium-0.1942.37e-178.54e-17
speciesSolobacterium_moorei-0.1942.37e-178.54e-17
genusFaecalibacterium-0.1942.56e-179.09e-17
speciesFaecalibacterium_prausnitzii-0.1942.56e-179.09e-17
speciesClostridium_nexile0.1942.87e-171.01e-16
genusRothia-0.1919.58e-173.35e-16
familyMicrococcaceae-0.199.85e-173.42e-16
phylumProteobacteria0.191.19e-164.1e-16
speciesAnaerotruncus_colihominis0.1891.74e-165.95e-16
speciesAnaerostipes_unclassified0.1891.76e-165.98e-16
classBetaproteobacteria0.1891.92e-166.47e-16
orderBurkholderiales0.1873.34e-161.12e-15
speciesStreptococcus_vestibularis-0.1873.72e-161.24e-15
speciesOdoribacter_splanchnicus0.1874.12e-161.36e-15
speciesRothia_mucilaginosa-0.1864.57e-161.5e-15
genusMitsuokella-0.1865.51e-161.79e-15
speciesRuminococcus_callidus-0.1858.28e-162.68e-15
speciesMitsuokella_unclassified-0.1858.49e-162.73e-15
speciesBacteroides_dorei0.184.61e-151.47e-14
speciesEubacterium_ventriosum-0.1789.26e-152.93e-14
genusClostridiaceae_noname0.1771.26e-143.94e-14
speciesClostridiaceae_bacterium_JC1180.1771.26e-143.94e-14
speciesClostridium_bartlettii-0.1771.49e-144.63e-14
genusPhascolarctobacterium-0.1752.12e-146.5e-14
speciesPhascolarctobacterium_succinatutens-0.1752.12e-146.5e-14
speciesButyrivibrio_crossotus-0.1744.03e-141.22e-13
genusMethanosphaera-0.1744.05e-141.22e-13
speciesMethanosphaera_stadtmanae-0.1744.05e-141.22e-13
speciesClostridium_sp_L2_50-0.1735.42e-141.62e-13
genusOdoribacter0.1735.55e-141.65e-13
speciesBacteroides_cellulosilyticus0.1726.55e-141.93e-13
speciesFusobacterium_varium0.1727.52e-142.2e-13
genusLeuconostoc-0.171.15e-133.33e-13
speciesStreptococcus_mutans-0.171.15e-133.33e-13
speciesPropionibacterium_freudenreichii-0.171.27e-133.66e-13
speciesParaprevotella_xylaniphila-0.171.6e-134.58e-13
speciesMethanobrevibacter_unclassified-0.1691.92e-135.46e-13
speciesLactobacillus_rhamnosus-0.1691.94e-135.48e-13
speciesRuminococcus_lactaris-0.1673.25e-139.13e-13
genusLactococcus-0.1674.05e-131.13e-12
speciesBifidobacterium_animalis-0.1665.78e-131.6e-12
speciesStreptococcus_gordonii-0.1656.17e-131.7e-12
speciesCoprococcus_eutactus-0.1657.24e-131.99e-12
phylumVerrucomicrobia-0.1649.11e-132.42e-12
classVerrucomicrobiae-0.1649.11e-132.42e-12
orderVerrucomicrobiales-0.1649.11e-132.42e-12
familyVerrucomicrobiaceae-0.1649.11e-132.42e-12
genusAkkermansia-0.1649.11e-132.42e-12
speciesAkkermansia_muciniphila-0.1649.11e-132.42e-12
speciesBifidobacterium_catenulatum-0.1595.15e-121.36e-11
familyClostridiaceae0.1595.44e-121.43e-11
genusBurkholderiales_noname0.1586.15e-121.59e-11
speciesBurkholderiales_bacterium_1_1_470.1586.15e-121.59e-11
familyBurkholderiales_noname0.1586.44e-121.66e-11
speciesLachnospiraceae_bacterium_9_1_43BFAA0.1586.6e-121.69e-11
speciesStreptococcus_australis-0.1561.28e-113.27e-11
genusClostridium0.1561.34e-113.4e-11
genusPropionibacterium-0.1551.63e-114.11e-11
speciesAlistipes_onderdonkii0.1551.75e-114.39e-11
speciesLachnospiraceae_bacterium_6_1_63FAA0.1533.09e-117.72e-11
speciesRoseburia_hominis-0.1533.32e-118.25e-11
speciesLactobacillus_casei_paracasei-0.1524.39e-111.08e-10
speciesTuricibacter_sanguinis-0.1514.82e-111.18e-10
speciesStreptococcus_anginosus-0.1515.5e-111.35e-10
familySutterellaceae0.1516.01e-111.46e-10
speciesDialister_succinatiphilus-0.1498.4e-112.03e-10
genusLachnospiraceae_noname-0.1471.64e-103.95e-10
genusTuricibacter-0.1471.69e-104.05e-10
speciesAnaerotruncus_unclassified-0.1462.04e-104.86e-10
genusParasutterella0.1462.21e-105.22e-10
speciesParasutterella_excrementihominis0.1462.21e-105.22e-10
speciesLactococcus_lactis-0.1453.36e-107.89e-10
familyLeuconostocaceae-0.1443.99e-109.32e-10
speciesEubacterium_sp_3_1_310.1435.47e-101.27e-09
speciesCoprobacillus_unclassified0.1427.2e-101.67e-09
speciesMitsuokella_multacida-0.1427.83e-101.8e-09
speciesBacteroides_plebeius-0.1419.78e-102.24e-09
speciesStreptococcus_mitis_oralis_pneumoniae-0.141.19e-092.71e-09
speciesOscillibacter_sp_KLE_17280.1391.69e-093.84e-09
genusGordonibacter-0.1382.1e-094.72e-09
speciesGordonibacter_pamelaeae-0.1382.1e-094.72e-09
speciesLachnospiraceae_bacterium_8_1_57FAA-0.1372.4e-095.37e-09
speciesRuminococcus_sp_JC304-0.1372.91e-096.48e-09
speciesLactobacillus_delbrueckii-0.1363.3e-097.31e-09
speciesLachnospiraceae_bacterium_3_1_46FAA-0.1354.43e-099.77e-09
speciesLactobacillus_ruminis-0.1355.11e-091.12e-08
speciesEubacterium_cylindroides-0.1337.22e-091.58e-08
speciesBacteroides_caccae0.1328.94e-091.94e-08
genusCoprobacillus0.1321.03e-082.23e-08
speciesClostridium_sp_ATCC_BAA_4420.1311.21e-082.61e-08
speciesTuricibacter_unclassified-0.1292.36e-085.06e-08
phylumViruses_noname-0.1273.26e-086.93e-08
classViruses_noname-0.1273.26e-086.93e-08
familyEnterococcaceae-0.1273.39e-087.18e-08
genusEnterococcus-0.1264.18e-088.81e-08
speciesEubacterium_eligens-0.1264.69e-089.84e-08
speciesBifidobacterium_dentium-0.1264.73e-089.88e-08
speciesLactococcus_phage_P680-0.1255.46e-081.14e-07
speciesBifidobacterium_bifidum-0.1255.72e-081.18e-07
speciesEggerthella_unclassified0.1256.21e-081.28e-07
speciesFusobacterium_mortiferum0.1247.01e-081.44e-07
genusSiphoviridae_noname-0.1247.8e-081.59e-07
speciesAlistipes_senegalensis-0.1221.25e-072.54e-07
speciesOscillibacter_sp_KLE_17450.1211.61e-073.26e-07
speciesEubacterium_dolichum0.121.74e-073.51e-07
speciesAlistipes_putredinis0.122.07e-074.16e-07
speciesRuminococcus_champanellensis-0.122.1e-074.2e-07
speciesErysipelotrichaceae_bacterium_21_3-0.1183.19e-076.35e-07
speciesClostridium_leptum-0.1164.94e-079.8e-07
speciesBacteroides_coprocola-0.1155.54e-071.09e-06
speciesEnterococcus_faecium-0.1156.7e-071.32e-06
speciesDorea_unclassified0.1148.45e-071.65e-06
speciesParabacteroides_merdae0.1138.68e-071.69e-06
genusBarnesiella-0.1121.27e-062.46e-06
speciesBarnesiella_intestinihominis-0.1121.27e-062.46e-06
speciesLachnospiraceae_bacterium_2_1_46FAA0.1111.34e-062.58e-06
speciesClostridium_ramosum0.1111.36e-062.61e-06
speciesBacteroides_sp_2_1_220.1111.6e-063.06e-06
speciesBacteroides_intestinalis0.1111.67e-063.18e-06
speciesBacteroides_coprophilus-0.1092.42e-064.59e-06
speciesBacteroides_oleiciplenus0.1092.49e-064.7e-06
familyAcidaminococcaceae-0.1083.06e-065.75e-06
genusEggerthella0.1073.89e-067.29e-06
speciesButyrivibrio_unclassified-0.1064.54e-068.47e-06
genusPeptostreptococcus-0.1054.98e-069.25e-06
speciesLactobacillus_gasseri-0.1045.99e-061.11e-05
familySiphoviridae-0.1047.25e-061.34e-05
speciesLachnospiraceae_bacterium_5_1_57FAA0.1038.48e-061.56e-05
speciesBacteroides_pectinophilus-0.1038.6e-061.57e-05
speciesEnterococcus_faecalis-0.11.59e-052.9e-05
familyPropionibacteriaceae-0.0991.86e-053.38e-05
speciesLachnospiraceae_bacterium_2_1_58FAA0.0981.99e-053.6e-05
speciesDesulfovibrio_piger-0.0982.22e-054e-05
speciesLachnospiraceae_bacterium_1_4_56FAA0.0982.31e-054.15e-05
speciesPrevotella_buccae0.0972.41e-054.31e-05
speciesEscherichia_coli0.0953.81e-056.79e-05
speciesCollinsella_unclassified0.0953.98e-057.06e-05
speciesHoldemania_sp_AP20.0935.14e-059.09e-05
classNegativicutes-0.0926.56e-050.000115
orderSelenomonadales-0.0926.56e-050.000115
speciesLactobacillus_plantarum-0.0927.06e-050.000123
genusParvimonas-0.0917.6e-050.000132
speciesParvimonas_unclassified-0.0917.6e-050.000132
orderCaudovirales-0.090.0001020.000176
genusEscherichia0.0890.0001240.000214
speciesCollinsella_intestinalis0.0890.0001260.000216
orderViruses_noname-0.0880.0001330.000227
speciesAlistipes_finegoldii0.0880.0001450.000247
speciesEggerthella_sp_1_3_56FAA-0.0870.0001630.000277
orderPseudomonadales-0.0860.0001820.000308
familyClostridiales_Family_XI_Incertae_Sedis-0.0860.0001960.00033
speciesAlistipes_shahii0.0850.0002370.000398
speciesBlautia_producta0.0830.0003160.000529
speciesPeptostreptococcus_stomatis-0.0820.0003570.000595
genusMorganella0.0820.0003680.000609
speciesMorganella_morganii0.0820.0003680.000609
genusPseudoflavonifractor-0.0810.0004460.000733
speciesPseudoflavonifractor_capillosus-0.0810.0004460.000733
speciesSutterella_wadsworthensis-0.0810.0004770.000782
genusButyricimonas0.080.0005150.000838
speciesButyricimonas_synergistica0.080.0005150.000838
speciesOdoribacter_unclassified-0.080.0005320.000863
speciesMegasphaera_elsdenii-0.0790.0005940.00096
speciesGemella_morbillorum-0.0790.0006520.00105
phylumSynergistetes0.0750.001140.00181
classSynergistia0.0750.001140.00181
orderSynergistales0.0750.001140.00181
familySynergistaceae0.0750.001140.00181
speciesPrevotella_bivia0.0750.001260.002
speciesKlebsiella_pneumoniae0.0740.001310.00207
genusPyramidobacter0.0740.001380.00216
speciesPyramidobacter_piscolens0.0740.001380.00216
speciesWeissella_cibaria-0.0740.001420.00222
genusCoprobacter-0.0730.001540.00239
speciesCoprobacter_fastidiosus-0.0730.001540.00239
speciesRoseburia_intestinalis-0.0730.001710.00265
speciesParabacteroides_goldsteinii0.0720.001720.00265
speciesLactococcus_phage_jm2-0.0720.001810.00278
orderEnterobacteriales0.0720.001890.00289
familyEnterobacteriaceae0.0720.001890.00289
speciesBacteroides_massiliensis0.0720.001930.00294
speciesRoseburia_inulinivorans-0.0710.002070.00314
speciesBacteroides_salyersiae0.0710.002110.00319
speciesLachnospiraceae_bacterium_7_1_58FAA0.0710.002160.00326
speciesLactococcus_garvieae-0.0680.003140.00472
genusHoldemania0.0670.003790.00568
speciesMegamonas_funiformis-0.0670.003830.00572
genusSutterella-0.0650.004990.00743
classGammaproteobacteria0.0640.00530.00787
speciesMegasphaera_micronuciformis0.0640.005390.00798
speciesSutterella_parvirubra0.0640.005620.00829
speciesStreptococcus_pasteurianus0.0630.006030.00887
speciesLactococcus_phage_phi7-0.0630.006060.00888
speciesLactobacillus_sanfranciscensis-0.0630.006720.00982
speciesSlackia_piriformis-0.0610.007970.0116
speciesParabacteroides_johnsonii0.060.009240.0134
speciesBacteroides_sp_1_1_60.060.009480.0137
speciesLactobacillus_fermentum-0.0590.01130.0163
genusSlackia-0.0580.01180.017
genusKlebsiella0.0580.01220.0175
speciesBifidobacterium_angulatum-0.0570.01430.0205
familyVeillonellaceae-0.0560.01490.0212
familyBacteroidales_noname-0.0560.0150.0212
genusBacteroidales_noname-0.0560.0150.0212
speciesBacteroidales_bacterium_ph8-0.0560.0150.0212
speciesBacteroides_barnesiae-0.0560.01520.0214
genusRoseburia-0.0560.01610.0226
speciesBlautia_hydrogenotrophica-0.0560.01630.0228
familyOxalobacteraceae-0.0540.01970.0275
genusOxalobacter-0.0540.02050.0285
speciesOxalobacter_formigenes-0.0540.02050.0285
speciesClostridium_spiroforme-0.0530.02090.0289
speciesBacteroides_clarus0.0520.02380.0328
speciesErysipelotrichaceae_bacterium_5_2_54FAA0.0520.02580.0355
genusPantoea0.0510.02720.0372
speciesPantoea_unclassified0.0510.02720.0372
speciesLactobacillus_acidophilus-0.0510.02890.0394
speciesAlistipes_sp_AP110.050.02960.0403
genusDialister-0.050.03010.0408
speciesLachnospiraceae_bacterium_1_1_57FAA-0.050.03070.0415
speciesKlebsiella_oxytoca-0.050.03130.0422
speciesErysipelotrichaceae_bacterium_3_1_530.0490.03420.046
speciesEnterobacteria_phage_HK5440.0470.04070.0546
genusRuminococcaceae_noname-0.0470.04170.0556
speciesRuminococcaceae_bacterium_D16-0.0470.04170.0556
speciesLactobacillus_vaginalis-0.0460.04630.0616
genusWeissella-0.0450.05060.0671
genusStaphylococcus-0.0440.05440.0719
speciesOdoribacter_laneus-0.0430.0620.0817
speciesLeuconostoc_lactis-0.0430.06470.0851
speciesC2likevirus_unclassified-0.0430.06520.0855
genusC2likevirus-0.0420.06880.09
speciesVeillonella_dispar0.0410.07460.0973
speciesBacteroides_eggerthii-0.0410.07610.099
genusButyricicoccus0.040.08260.107
speciesButyricicoccus_pullicaecorum0.040.08260.107
speciesFusobacterium_nucleatum0.0390.09230.119
speciesEggerthella_lenta-0.0390.09270.119
genusCampylobacter0.0390.09330.12
speciesKlebsiella_unclassified0.0390.09510.122
speciesAlistipes_sp_HGB50.0380.09850.125
speciesBacteroides_salanitronis-0.0380.09880.125
genusDesulfovibrio-0.0380.09890.125
speciesLactobacillus_amylovorus-0.0380.1030.13
familyStaphylococcaceae-0.0380.1040.131
speciesBacteroides_sp_3_1_190.0370.1050.132
familyCampylobacteraceae0.0370.1070.134
speciesKlebsiella_sp_MS_92_30.0370.1090.136
genusAnaerotruncus-0.0370.1110.139
speciesClostridium_sp_KLE_17550.0360.1150.143
speciesLactobacillus_mucosae-0.0370.1150.143
speciesLactobacillus_reuteri-0.0360.1170.145
speciesMegamonas_hypermegale-0.0360.120.148
familyViruses_noname-0.0360.1220.15
genusViruses_noname-0.0360.1220.15
speciesRoseburia_unclassified-0.0360.1220.15
familySuccinivibrionaceae-0.0350.1260.154
speciesLactobacillus_crispatus-0.0340.1370.167
speciesParabacteroides_sp_D13-0.0340.1370.167
genusSuccinatimonas-0.0340.1430.173
speciesSuccinatimonas_hippei-0.0340.1430.173
speciesAcidaminococcus_fermentans-0.0320.1610.194
speciesLactobacillus_oris-0.0320.1660.2
speciesWeissella_confusa-0.0320.1670.201
speciesPeptostreptococcus_anaerobius-0.0320.1680.201
speciesPrevotella_stercorea-0.0310.1820.217
speciesBifidobacterium_breve-0.0310.1840.219
familyPodoviridae0.0310.1860.221
classEpsilonproteobacteria0.0290.2050.243
orderCampylobacterales0.0290.2050.243
speciesCollinsella_tanakaei0.0290.2070.244
speciesHaemophilus_parainfluenzae0.0290.2070.244
genusHaemophilus0.0290.2160.254
orderPasteurellales0.0280.2230.261
familyPasteurellaceae0.0280.2230.261
speciesSubdoligranulum_sp_4_3_54A2FAA0.0270.2440.284
genusEnterobacter-0.0260.2670.31
speciesAcidaminococcus_intestini0.0250.2770.321
speciesAcidaminococcus_unclassified0.0250.2790.323
genusMegasphaera0.0250.2830.327
speciesEnterobacter_cloacae-0.0250.2880.332
speciesClostridium_perfringens-0.0230.3220.37
speciesBacteroides_sp_4_3_47FAA0.0230.3270.375
genusAcidaminococcaceae_unclassified0.0210.3730.425
speciesProteus_mirabilis0.0210.3740.425
speciesParabacteroides_sp_20_3-0.0210.3740.425
speciesAlistipes_unclassified0.020.3870.439
orderAeromonadales-0.020.390.441
speciesCampylobacter_concisus0.020.3960.447
speciesDialister_invisus0.0190.4010.452
genusLambdalikevirus-0.0180.4260.479
genusCitrobacter0.0180.4460.5
speciesCitrobacter_unclassified0.0170.4550.508
speciesAlistipes_indistinctus-0.0170.4550.508
genusProteus0.0170.4710.524
speciesBacteroides_faecis-0.0160.490.544
genusAcidaminococcus0.0150.5110.566
speciesHaemophilus_paraphrohaemolyticus-0.0150.5210.576
speciesVeillonella_parvula0.0150.5280.582
speciesCitrobacter_freundii0.0140.5460.6
genusPorphyromonas-0.0140.5470.6
speciesEnterobacter_aerogenes-0.0140.5580.611
speciesDesulfovibrio_desulfuricans0.0130.5620.614
speciesBacteroides_fluxus-0.0130.5720.624
speciesAggregatibacter_segnis-0.0120.5940.646
speciesBacteroides_finegoldii0.0120.5990.65
genusTunalikevirus-0.0120.610.66
genusSutterellaceae_unclassified0.0120.6160.665
speciesMegamonas_rupellensis0.0110.620.668
speciesHaemophilus_sputorum-0.0110.6230.67
speciesEubacterium_limosum0.0110.6350.681
speciesStreptococcus_infantarius0.010.6670.714
speciesEscherichia_unclassified0.0090.6810.727
speciesKlebsiella_phage_KP36-0.0090.6940.739
genusActinobacillus-0.0090.7040.747
speciesActinobacillus_unclassified-0.0090.7040.747
speciesVeillonella_unclassified-0.0080.7350.778
speciesPorphyromonas_asaccharolytica-0.0080.740.781
speciesPorphyromonas_uenonis0.0070.7470.787
speciesLactococcus_phage_bIL67-0.0070.7590.798
speciesStreptococcus_phage_Sfi21-0.0060.7910.83
speciesCoriobacteriaceae_bacterium_phI0.0060.80.836
speciesCoprobacillus_sp_29_10.0060.8010.836
genusMyoviridae_noname-0.0050.8150.849
speciesErysipelotrichaceae_bacterium_6_1_45-0.0050.8270.86
speciesErysipelotrichaceae_bacterium_2_2_44A0.0050.8310.862
speciesMegamonas_unclassified-0.0050.8430.873
speciesLactobacillus_salivarius0.0040.8490.877
genusMegamonas-0.0040.8530.879
speciesHoldemania_unclassified0.0040.8630.887
speciesVeillonella_atypica0.0040.8640.887
genusPeptoniphilus0.0040.8670.888
speciesMegasphaera_unclassified0.0040.8740.892
genusCoriobacteriaceae_noname0.0040.8750.892
genusVeillonella0.0030.8860.901
speciesStreptococcus_lutetiensis0.0030.9020.916
genusAggregatibacter-0.0020.9140.926
speciesBifidobacterium_pseudocatenulatum-0.0020.9250.935
speciesHoldemania_filiformis0.0010.9590.964
speciesLachnospiraceae_bacterium_3_1_57FAA_CT10.0010.9610.964
speciesLactococcus_phage_936_sensu_lato0.0010.9630.964
familyMyoviridae0.0010.9640.964
speciesCoprobacillus_sp_D6-0.0010.9640.964
Click on arrows to sort table data. Shift+click to sort by multiple columns.

Association of query gene abundance with clinical phenotypes:

Boxplots:


Statistics:

pheno country case_n ctrl_n case_mean ctrl_mean pvalue rank percentile
Crohns diseaseSpain17660.6036278648170.2978650766252.33236762059e-063851.28013
Type II diabetesDenmark752770.3936783195760.3315284068970.00938806870604425813.9575
Rheumatoid arthritisChina127980.3539047337320.3155928695360.044352171419229069.69087
ObesityDenmark1691230.3461970487450.3084760868450.0590819722084544317.8981
Type II diabetesChina1831850.4955343938860.4609637546750.1120632455041004233.1868
Liver cirrhosisChina1201140.5114148095380.4783009916730.4336236624822351578.9916
Colorectal cancerAustria64350.1662605554270.1675509682040.4619834887241656256.036
Ulcerative colitisSpain78660.2879377652950.2978650766250.7613637048962492282.2128
Type II diabetesSweden53920.1787581333430.1849439806860.8519350552632555586.5391
Click on arrows to sort table data. Shift+click to sort by multiple columns.

Citation:

Nayfach S, Fischbach MA, Pollard KS. MetaQuery: a web server for rapid annotation and quantitative analysis of specific genes in the human gut microbiome. Bioinformatics 2015;31(14). doi:10.1093/bioinformatics/btv382